PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927489.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 575aa    MW: 63724.2 Da    PI: 4.3346
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927489.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1622.2e-50371632128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppG+rFhPtdeelv ++Lk+kv +++++l  +i +vd+yk+ePw+Lp k  +k+++k+wyfFs+rd+ky++g+r+nratk gyWkatgkd+++ +
  XP_010927489.1  37 PPGVRFHPTDEELVLYHLKRKVCRRRFRL-PMIGDVDVYKWEPWELPeKsLLKSGDKQWYFFSPRDRKYPNGSRSNRATKCGYWKATGKDRTISQ 130
                     8*************************999.88**************9535778899*************************************99 PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      k+++ g kktLv+y+grap+ge+tdWvm ey+l
  XP_010927489.1 131 -KSKAAGNKKTLVYYRGRAPRGERTDWVMYEYTL 163
                     .9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-5733186IPR003441NAC domain
PROSITE profilePS5100553.84136186IPR003441NAC domain
PfamPF023651.2E-2537163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MGAAPECGGP MSRRSGDDGD EDGGVAGLAL GKANWWPPGV RFHPTDEELV LYHLKRKVCR  60
RRFRLPMIGD VDVYKWEPWE LPEKSLLKSG DKQWYFFSPR DRKYPNGSRS NRATKCGYWK  120
ATGKDRTISQ KSKAAGNKKT LVYYRGRAPR GERTDWVMYE YTLDDQRLMS CSNVQDSYAL  180
YKLFRKSGPG PKNGEQYGAP FREEEWDDDD KDDSLNQNSK EDTMPGRPHG GDSTGLFGDE  240
GSMLPMDDLE DLLLQISDEQ DIIPQPSECS AYVSEIDVEA EVGSLTVVPS LGDANFTEQN  300
LNWCELINEE PDLQIAEPDP PDMLHIETPV ITSINFSDQG QLRIDEEFLE IRDFNDPEST  360
EWRVDDASDR DIVHDTGGFY DTYGYFDAPM FLAEEFEPLD GAGQNPYFDE TEASLITTEL  420
WTHEQDFSAS TXGESDHVIT APPASGIVNA STSNVGVNTQ GQFSSVRGAS DSWFGSALSA  480
LLDSVPSRPA IASENALISR AFQRVSSFRA GQIGAQEPNA TTGGGIVASG RQRGSHNGGF  540
LFISFLVGLV AVFWVLTIGV ALKVFRGLWG KFISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-483716316140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927489.10.0PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 74-like
TrEMBLM0TT810.0M0TT81_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P24280_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1851269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-84NAC domain containing protein 17